PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0284s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 300aa    MW: 34191 Da    PI: 6.875
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0284s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1652.7e-51111351129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhP+deelv++yL kkv+  +  l   + evd++++ePwd+p ++  + kewyf+s+rd+kyatg r+nrat+sgyWkatg
  SapurV1A.0284s0040.1.p  11 LPPGFRFHPRDEELVCDYLMKKVSCCDSLL---MIEVDLNRCEPWDIPDTACVGGKEWYFYSQRDRKYATGLRTNRATASGYWKATG 94 
                             79**********************998444...889************7666789******************************** PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             kd+++l+ +g+lvg++ktLvfy+grapkg+ktdWvmhe+rle
  SapurV1A.0284s0040.1.p  95 KDRHILR-EGTLVGMRKTLVFYQGRAPKGKKTDWVMHEFRLE 135
                             ******9.999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-592160IPR003441NAC domain
PROSITE profilePS5100555.62411159IPR003441NAC domain
PfamPF023658.9E-2712134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MSNISFVEAK LPPGFRFHPR DEELVCDYLM KKVSCCDSLL MIEVDLNRCE PWDIPDTACV  60
GGKEWYFYSQ RDRKYATGLR TNRATASGYW KATGKDRHIL REGTLVGMRK TLVFYQGRAP  120
KGKKTDWVMH EFRLEGPLLG RPNFFSEKED WVLCRVFYKN TREVMAKPSI RSCYDDTGSS  180
SLPALMDSYI TFDQTQPNLD EHEQVPCFSI FSQIQPNQSF PYITQMEVPN LPIKSTSPFA  240
QVPINITTPL DSFSCDTKVL KAVLNRISMM ENKGSPSLGE GSSESYLSDV GMPNLWNNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-52616112167NAC domain-containing protein 19
4dul_A2e-52616112167NAC domain-containing protein 19
1ut7_B2e-52616112167NO APICAL MERISTEM PROTEIN
1ut7_A2e-52616112167NO APICAL MERISTEM PROTEIN
1ut4_B2e-52616112167NO APICAL MERISTEM PROTEIN
1ut4_A2e-52616112167NO APICAL MERISTEM PROTEIN
3swp_D2e-52616115170NAC domain-containing protein 19
3swp_C2e-52616115170NAC domain-containing protein 19
3swp_B2e-52616115170NAC domain-containing protein 19
3swp_A2e-52616115170NAC domain-containing protein 19
3swm_D2e-52616115170NAC domain-containing protein 19
3swm_C2e-52616115170NAC domain-containing protein 19
3swm_B2e-52616115170NAC domain-containing protein 19
3swm_A2e-52616115170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5342400.0JX534240.1 Populus tremula x Populus alba NAC1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310688.10.0transcription activator NAC1 family protein
SwissprotQ84TE61e-117NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLB9HH130.0B9HH13_POPTR; Transcription activator NAC1 family protein
STRINGGLYMA15G40510.11e-161(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100103241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-110NAC domain containing protein 1